Placeholder image of a protein
Icon representing a puzzle

1247: Revisiting Puzzle 57: Beta-Neurotoxin

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary


Created
June 15, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This scorpion toxin is similar to the one from Puzzle 55, and binds to voltage-gated ion channels of insects. The protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


KDGYLVEKTGCKKTCYKLGENDFCNRECKWKHIGGSYGYCYGFGCYCEGLPDSTQTWPLPNKTC

Top groups


  1. Avatar for Contenders 100 pts. 9,880
  2. Avatar for L'Alliance Francophone 2. L'Alliance Francophone 74 pts. 9,847
  3. Avatar for Go Science 3. Go Science 54 pts. 9,837
  4. Avatar for Void Crushers 4. Void Crushers 38 pts. 9,819
  5. Avatar for Gargleblasters 5. Gargleblasters 27 pts. 9,818
  6. Avatar for Beta Folders 6. Beta Folders 18 pts. 9,817
  7. Avatar for Anthropic Dreams 7. Anthropic Dreams 12 pts. 9,805
  8. Avatar for Deleted group 8. Deleted group pts. 9,451
  9. Avatar for Italiani Al Lavoro 9. Italiani Al Lavoro 5 pts. 9,344
  10. Avatar for It's over 9000! 10. It's over 9000! 3 pts. 9,268

  1. Avatar for joremen 51. joremen Lv 1 24 pts. 9,493
  2. Avatar for pvc78 52. pvc78 Lv 1 24 pts. 9,469
  3. Avatar for guineapig 53. guineapig Lv 1 23 pts. 9,451
  4. Avatar for drumpeter18yrs9yrs 54. drumpeter18yrs9yrs Lv 1 22 pts. 9,451
  5. Avatar for diamonddays 55. diamonddays Lv 1 21 pts. 9,445
  6. Avatar for weitzen 56. weitzen Lv 1 21 pts. 9,444
  7. Avatar for TomTaylor 57. TomTaylor Lv 1 20 pts. 9,430
  8. Avatar for NinjaGreg 58. NinjaGreg Lv 1 19 pts. 9,429
  9. Avatar for jamiexq 59. jamiexq Lv 1 19 pts. 9,419
  10. Avatar for altejoh 60. altejoh Lv 1 18 pts. 9,408

Comments