1247: Revisiting Puzzle 57: Beta-Neurotoxin

Closed since over 9 years ago

Summary

• Created: June 15, 2016
• Expires: June 22, 2016 at 18:00 UTC
• Max points: 100

Description

This is a throwback puzzle to the early days of Foldit. This scorpion toxin is similar to the one from Puzzle 55, and binds to voltage-gated ion channels of insects. The protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

KDGYLVEKTGCKKTCYKLGENDFCNRECKWKHIGGSYGYCYGFGCYCEGLPDSTQTWPLPNKTC

Top groups

• 1. Contenders 100 pts. 9,880
• 2. L'Alliance Francophone 74 pts. 9,847
• 3. Go Science 54 pts. 9,837
• 4. Void Crushers 38 pts. 9,819
• 5. Gargleblasters 27 pts. 9,818
• 6. Beta Folders 18 pts. 9,817
• 7. Anthropic Dreams 12 pts. 9,805
• 8. Deleted group pts. 9,451
• 9. Italiani Al Lavoro 5 pts. 9,344
• 10. It's over 9000! 3 pts. 9,268

Top soloists

• 11. Galaxie 78 pts. 9,804
• 12. frood66 76 pts. 9,802
• 13. christioanchauvin 74 pts. 9,799
• 14. Skippysk8s 72 pts. 9,797
• 15. Deleted player pts. 9,774
• 16. dcrwheeler 68 pts. 9,774
• 17. actiasluna 67 pts. 9,745
• 18. Bruno Kestemont 65 pts. 9,738
• 19. ZeroLeak7 63 pts. 9,709
• 20. Blipperman 61 pts. 9,709