Placeholder image of a protein
Icon representing a puzzle

1247: Revisiting Puzzle 57: Beta-Neurotoxin

Closed since over 9 years ago

Intermediate Overall Prediction

Summary

Created
June 15, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This scorpion toxin is similar to the one from Puzzle 55, and binds to voltage-gated ion channels of insects. The protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


KDGYLVEKTGCKKTCYKLGENDFCNRECKWKHIGGSYGYCYGFGCYCEGLPDSTQTWPLPNKTC

Top groups

  1. Avatar for Contenders
    1. Contenders
    100 pts. 9,880
  2. Avatar for L'Alliance Francophone 2. L'Alliance Francophone 74 pts. 9,847
  3. Avatar for Go Science 3. Go Science 54 pts. 9,837
  4. Avatar for Void Crushers 4. Void Crushers 38 pts. 9,819
  5. Avatar for Gargleblasters 5. Gargleblasters 27 pts. 9,818
  6. Avatar for Beta Folders 6. Beta Folders 18 pts. 9,817
  7. Avatar for Anthropic Dreams 7. Anthropic Dreams 12 pts. 9,805
  8. Avatar for Deleted group 8. Deleted group pts. 9,451
  9. Avatar for Italiani Al Lavoro 9. Italiani Al Lavoro 5 pts. 9,344
  10. Avatar for It's over 9000! 10. It's over 9000! 3 pts. 9,268
  1. Avatar for alwen 71. alwen Lv 1 12 pts. 9,293
  2. Avatar for Vinara 72. Vinara Lv 1 12 pts. 9,292
  3. Avatar for caglar 73. caglar Lv 1 11 pts. 9,279
  4. Avatar for smholst 74. smholst Lv 1 11 pts. 9,276
  5. Avatar for SKSbell 75. SKSbell Lv 1 11 pts. 9,274
  6. Avatar for BCAA 76. BCAA Lv 1 10 pts. 9,268
  7. Avatar for TastyMunchies 77. TastyMunchies Lv 1 10 pts. 9,244
  8. Avatar for smilingone 78. smilingone Lv 1 9 pts. 9,233
  9. Avatar for Deleted player 79. Deleted player pts. 9,228
  10. Avatar for phi16 80. phi16 Lv 1 9 pts. 9,215

Comments