Placeholder image of a protein
Icon representing a puzzle

1252: Unsolved De-novo Freestyle 82

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary

Created
June 26, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


MAASSRAQVLSLYRAMLRESKRFSAYNYRTYAVRRIRDAFRENKNVKDPVEIQTLVNKAKRDLGVIRRQVHIGQLYSTDKLIIENRDMPRT

Top groups

  1. Avatar for SETI.Germany 11. SETI.Germany 1 pt. 8,455
  2. Avatar for It's over 9000! 12. It's over 9000! 1 pt. 8,308
  3. Avatar for Deleted group 13. Deleted group pts. 8,234
  4. Avatar for Mojo Risin' 14. Mojo Risin' 1 pt. 7,609
  5. Avatar for freefolder 15. freefolder 1 pt. 7,380
  6. Avatar for DSN @ Home 16. DSN @ Home 1 pt. 0
  1. Avatar for smholst 41. smholst Lv 1 27 pts. 8,744
  2. Avatar for LociOiling 42. LociOiling Lv 1 26 pts. 8,739
  3. Avatar for nicobul 43. nicobul Lv 1 25 pts. 8,736
  4. Avatar for arcsign 44. arcsign Lv 1 24 pts. 8,732
  5. Avatar for Bruno Kestemont 45. Bruno Kestemont Lv 1 23 pts. 8,732
  6. Avatar for Mike Cassidy 46. Mike Cassidy Lv 1 22 pts. 8,729
  7. Avatar for TastyMunchies 47. TastyMunchies Lv 1 21 pts. 8,728
  8. Avatar for heather-1 48. heather-1 Lv 1 21 pts. 8,720
  9. Avatar for joremen 49. joremen Lv 1 20 pts. 8,720
  10. Avatar for Deleted player 50. Deleted player pts. 8,719

Comments