Placeholder image of a protein
Icon representing a puzzle

1252: Unsolved De-novo Freestyle 82

Closed since almost 10 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
June 26, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


MAASSRAQVLSLYRAMLRESKRFSAYNYRTYAVRRIRDAFRENKNVKDPVEIQTLVNKAKRDLGVIRRQVHIGQLYSTDKLIIENRDMPRT

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 9,087
  2. Avatar for Void Crushers 2. Void Crushers 71 pts. 9,025
  3. Avatar for Gargleblasters 3. Gargleblasters 49 pts. 9,025
  4. Avatar for Go Science 4. Go Science 33 pts. 9,021
  5. Avatar for Beta Folders 5. Beta Folders 22 pts. 9,015
  6. Avatar for Contenders 6. Contenders 14 pts. 8,943
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 8 pts. 8,891
  8. Avatar for Italiani Al Lavoro 8. Italiani Al Lavoro 5 pts. 8,670
  9. Avatar for Deleted group 9. Deleted group pts. 8,488
  10. Avatar for xkcd 10. xkcd 2 pts. 8,482

  1. Avatar for smholst 41. smholst Lv 1 27 pts. 8,744
  2. Avatar for LociOiling 42. LociOiling Lv 1 26 pts. 8,739
  3. Avatar for nicobul 43. nicobul Lv 1 25 pts. 8,736
  4. Avatar for arcsign 44. arcsign Lv 1 24 pts. 8,732
  5. Avatar for Bruno Kestemont 45. Bruno Kestemont Lv 1 23 pts. 8,732
  6. Avatar for Mike Cassidy 46. Mike Cassidy Lv 1 22 pts. 8,729
  7. Avatar for TastyMunchies 47. TastyMunchies Lv 1 21 pts. 8,728
  8. Avatar for heather-1 48. heather-1 Lv 1 21 pts. 8,720
  9. Avatar for joremen 49. joremen Lv 1 20 pts. 8,720
  10. Avatar for Deleted player 50. Deleted player pts. 8,719

Comments