Placeholder image of a protein
Icon representing a puzzle

1253: Revisiting Puzzle 59: TCR Binding Protein

Closed since almost 10 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
June 28, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small, intracellular domain binds to the CD2 T cell receptor (TCR), and plays a critical role in T cell activation during the immune response. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


DVMWEYKWENTGDAELYGPFTSAQMQTWVSEGYFPDGVYCRKLDPPGGQFYNSKRIDFDLYT

Top groups


  1. Avatar for Go Science 100 pts. 9,090
  2. Avatar for Void Crushers 2. Void Crushers 71 pts. 9,041
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 49 pts. 9,032
  4. Avatar for Beta Folders 4. Beta Folders 33 pts. 9,012
  5. Avatar for Gargleblasters 5. Gargleblasters 22 pts. 9,004
  6. Avatar for Contenders 6. Contenders 14 pts. 8,992
  7. Avatar for Anthropic Dreams 7. Anthropic Dreams 8 pts. 8,956
  8. Avatar for Deleted group 8. Deleted group pts. 8,816
  9. Avatar for Italiani Al Lavoro 9. Italiani Al Lavoro 3 pts. 8,792
  10. Avatar for Deleted group 10. Deleted group pts. 8,737

  1. Avatar for GoodGuyGreg 151. GoodGuyGreg Lv 1 1 pt. 8,216
  2. Avatar for parsnip 152. parsnip Lv 1 1 pt. 8,199
  3. Avatar for gmccutcheon 153. gmccutcheon Lv 1 1 pt. 8,199
  4. Avatar for mirjamvandelft 154. mirjamvandelft Lv 1 1 pt. 8,184
  5. Avatar for larry25427 155. larry25427 Lv 1 1 pt. 8,179
  6. Avatar for roman madala 156. roman madala Lv 1 1 pt. 8,167
  7. Avatar for emcsquare 157. emcsquare Lv 1 1 pt. 8,140
  8. Avatar for Cerzax 158. Cerzax Lv 1 1 pt. 8,122
  9. Avatar for Tac1 159. Tac1 Lv 1 1 pt. 8,116
  10. Avatar for FranziS 160. FranziS Lv 1 1 pt. 8,106

Comments