Placeholder image of a protein
Icon representing a puzzle

1253: Revisiting Puzzle 59: TCR Binding Protein

Closed since over 9 years ago

Intermediate Overall Prediction

Summary


Created
June 28, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small, intracellular domain binds to the CD2 T cell receptor (TCR), and plays a critical role in T cell activation during the immune response. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


DVMWEYKWENTGDAELYGPFTSAQMQTWVSEGYFPDGVYCRKLDPPGGQFYNSKRIDFDLYT

Top groups


  1. Avatar for Go Science 100 pts. 9,090
  2. Avatar for Void Crushers 2. Void Crushers 71 pts. 9,041
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 49 pts. 9,032
  4. Avatar for Beta Folders 4. Beta Folders 33 pts. 9,012
  5. Avatar for Gargleblasters 5. Gargleblasters 22 pts. 9,004
  6. Avatar for Contenders 6. Contenders 14 pts. 8,992
  7. Avatar for Anthropic Dreams 7. Anthropic Dreams 8 pts. 8,956
  8. Avatar for Deleted group 8. Deleted group pts. 8,816
  9. Avatar for Italiani Al Lavoro 9. Italiani Al Lavoro 3 pts. 8,792
  10. Avatar for Deleted group 10. Deleted group pts. 8,737

  1. Avatar for aspadistra 161. aspadistra Lv 1 1 pt. 8,098
  2. Avatar for poiuyqwert 162. poiuyqwert Lv 1 1 pt. 8,095
  3. Avatar for fuzzykitty3 163. fuzzykitty3 Lv 1 1 pt. 8,086
  4. Avatar for jbmkfm125 164. jbmkfm125 Lv 1 1 pt. 8,084
  5. Avatar for science-mathguy 165. science-mathguy Lv 1 1 pt. 8,074
  6. Avatar for Monofilo 166. Monofilo Lv 1 1 pt. 8,057
  7. Avatar for daviditur 167. daviditur Lv 1 1 pt. 8,044
  8. Avatar for NotJim99 168. NotJim99 Lv 1 1 pt. 8,036
  9. Avatar for justinlandicho 169. justinlandicho Lv 1 1 pt. 7,942
  10. Avatar for lysineftw 170. lysineftw Lv 1 1 pt. 7,824

Comments