Placeholder image of a protein
Icon representing a puzzle

1255: Unsolved De-novo Freestyle 82: Predicted Contacts

Closed since over 9 years ago

Intermediate Overall Prediction Predicted Contacts

Summary

Created
July 04, 2016
Expires
Max points
100
Description

This is a follow-up puzzle for Puzzle 1252, now with Predicted Contacts to help guide your folding! See the blog for information on using the contact map. You can see the predicted contacts for this protein by clicking the Contact Map button in the Main menu (Selection Interface) or in the Actions tab (Classic Interface). You will notice that different contacts are shown in different shades of green, with brighter green contacts indicating stronger predictions. Players will be able to load in manual saves from Puzzle 1252 and use them as a starting point here.



Sequence:


MAASSRAQVLSLYRAMLRESKRFSAYNYRTYAVRRIRDAFRENKNVKDPVEIQTLVNKAKRDLGVIRRQVHIGQLYSTDKLIIENRDMPRT

Top groups

  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 1 pt. 10,377
  2. Avatar for It's over 9000! 12. It's over 9000! 1 pt. 10,159
  3. Avatar for DSN @ Home 13. DSN @ Home 1 pt. 7,241
  1. Avatar for Shadow1138 161. Shadow1138 Lv 1 1 pt. 6,606
  2. Avatar for Fjellryn 162. Fjellryn Lv 1 1 pt. 6,160
  3. Avatar for grulk 163. grulk Lv 1 1 pt. 5,827
  4. Avatar for varjo1 164. varjo1 Lv 1 1 pt. 5,647
  5. Avatar for dark_v3ng3nc3 165. dark_v3ng3nc3 Lv 1 1 pt. 5,563
  6. Avatar for jebbiek 166. jebbiek Lv 1 1 pt. 5,537
  7. Avatar for Marcell1993 167. Marcell1993 Lv 1 1 pt. 5,196
  8. Avatar for omegablue 168. omegablue Lv 1 1 pt. 5,134
  9. Avatar for moanwar.bio12 169. moanwar.bio12 Lv 1 1 pt. 5,053
  10. Avatar for cerratlan 170. cerratlan Lv 1 1 pt. 5,010

Comments