Placeholder image of a protein
Icon representing a puzzle

1255: Unsolved De-novo Freestyle 82: Predicted Contacts

Closed since over 9 years ago

Intermediate Overall Prediction Predicted Contacts

Summary


Created
July 04, 2016
Expires
Max points
100
Description

This is a follow-up puzzle for Puzzle 1252, now with Predicted Contacts to help guide your folding! See the blog for information on using the contact map. You can see the predicted contacts for this protein by clicking the Contact Map button in the Main menu (Selection Interface) or in the Actions tab (Classic Interface). You will notice that different contacts are shown in different shades of green, with brighter green contacts indicating stronger predictions. Players will be able to load in manual saves from Puzzle 1252 and use them as a starting point here.



Sequence:


MAASSRAQVLSLYRAMLRESKRFSAYNYRTYAVRRIRDAFRENKNVKDPVEIQTLVNKAKRDLGVIRRQVHIGQLYSTDKLIIENRDMPRT

Top groups


  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 1 pt. 10,377
  2. Avatar for It's over 9000! 12. It's over 9000! 1 pt. 10,159
  3. Avatar for DSN @ Home 13. DSN @ Home 1 pt. 7,241

  1. Avatar for jeff101 51. jeff101 Lv 1 22 pts. 10,753
  2. Avatar for pfirth 52. pfirth Lv 1 21 pts. 10,748
  3. Avatar for Anfinsen_slept_here 53. Anfinsen_slept_here Lv 1 20 pts. 10,746
  4. Avatar for Mike Cassidy 54. Mike Cassidy Lv 1 19 pts. 10,740
  5. Avatar for Satina 55. Satina Lv 1 19 pts. 10,734
  6. Avatar for YeshuaLives 56. YeshuaLives Lv 1 18 pts. 10,721
  7. Avatar for Fetztastic 57. Fetztastic Lv 1 17 pts. 10,716
  8. Avatar for Bautho 58. Bautho Lv 1 17 pts. 10,694
  9. Avatar for smholst 59. smholst Lv 1 16 pts. 10,693
  10. Avatar for NinjaGreg 60. NinjaGreg Lv 1 16 pts. 10,675

Comments