Placeholder image of a protein
Icon representing a puzzle

1255: Unsolved De-novo Freestyle 82: Predicted Contacts

Closed since over 9 years ago

Intermediate Overall Prediction Predicted Contacts

Summary

Created
July 04, 2016
Expires
Max points
100
Description

This is a follow-up puzzle for Puzzle 1252, now with Predicted Contacts to help guide your folding! See the blog for information on using the contact map. You can see the predicted contacts for this protein by clicking the Contact Map button in the Main menu (Selection Interface) or in the Actions tab (Classic Interface). You will notice that different contacts are shown in different shades of green, with brighter green contacts indicating stronger predictions. Players will be able to load in manual saves from Puzzle 1252 and use them as a starting point here.



Sequence:


MAASSRAQVLSLYRAMLRESKRFSAYNYRTYAVRRIRDAFRENKNVKDPVEIQTLVNKAKRDLGVIRRQVHIGQLYSTDKLIIENRDMPRT

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 12,045
  2. Avatar for Contenders 2. Contenders 65 pts. 11,898
  3. Avatar for Go Science 3. Go Science 41 pts. 11,672
  4. Avatar for Gargleblasters 4. Gargleblasters 24 pts. 11,547
  5. Avatar for Beta Folders 5. Beta Folders 14 pts. 11,534
  6. Avatar for Deleted group 6. Deleted group pts. 11,380
  7. Avatar for Void Crushers 7. Void Crushers 4 pts. 11,148
  8. Avatar for SETI.Germany 8. SETI.Germany 2 pts. 10,981
  9. Avatar for L'Alliance Francophone 9. L'Alliance Francophone 1 pt. 10,955
  10. Avatar for Deleted group 10. Deleted group pts. 10,392
  1. Avatar for jeff101 51. jeff101 Lv 1 22 pts. 10,753
  2. Avatar for pfirth 52. pfirth Lv 1 21 pts. 10,748
  3. Avatar for Anfinsen_slept_here 53. Anfinsen_slept_here Lv 1 20 pts. 10,746
  4. Avatar for Mike Cassidy 54. Mike Cassidy Lv 1 19 pts. 10,740
  5. Avatar for Satina 55. Satina Lv 1 19 pts. 10,734
  6. Avatar for YeshuaLives 56. YeshuaLives Lv 1 18 pts. 10,721
  7. Avatar for Fetztastic 57. Fetztastic Lv 1 17 pts. 10,716
  8. Avatar for Bautho 58. Bautho Lv 1 17 pts. 10,694
  9. Avatar for smholst 59. smholst Lv 1 16 pts. 10,693
  10. Avatar for NinjaGreg 60. NinjaGreg Lv 1 16 pts. 10,675

Comments