Placeholder image of a protein
Icon representing a puzzle

1255: Unsolved De-novo Freestyle 82: Predicted Contacts

Closed since almost 10 years ago

Intermediate Overall Prediction Predicted Contacts

Summary

Created
July 04, 2016
Expires
Max points
100
Description

This is a follow-up puzzle for Puzzle 1252, now with Predicted Contacts to help guide your folding! See the blog for information on using the contact map. You can see the predicted contacts for this protein by clicking the Contact Map button in the Main menu (Selection Interface) or in the Actions tab (Classic Interface). You will notice that different contacts are shown in different shades of green, with brighter green contacts indicating stronger predictions. Players will be able to load in manual saves from Puzzle 1252 and use them as a starting point here.



Sequence:


MAASSRAQVLSLYRAMLRESKRFSAYNYRTYAVRRIRDAFRENKNVKDPVEIQTLVNKAKRDLGVIRRQVHIGQLYSTDKLIIENRDMPRT

Top groups

  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 1 pt. 10,377
  2. Avatar for It's over 9000! 12. It's over 9000! 1 pt. 10,159
  3. Avatar for DSN @ Home 13. DSN @ Home 1 pt. 7,241
  1. Avatar for gcm24 61. gcm24 Lv 1 15 pts. 10,663
  2. Avatar for hansvandenhof 62. hansvandenhof Lv 1 14 pts. 10,658
  3. Avatar for georg137 63. georg137 Lv 1 14 pts. 10,648
  4. Avatar for jobo0502 64. jobo0502 Lv 1 13 pts. 10,641
  5. Avatar for weitzen 65. weitzen Lv 1 13 pts. 10,621
  6. Avatar for Blipperman 66. Blipperman Lv 1 12 pts. 10,620
  7. Avatar for ViJay7019 67. ViJay7019 Lv 1 12 pts. 10,617
  8. Avatar for Ashrai 68. Ashrai Lv 1 11 pts. 10,546
  9. Avatar for dssb 69. dssb Lv 1 11 pts. 10,516
  10. Avatar for YGK 70. YGK Lv 1 11 pts. 10,508

Comments