Placeholder image of a protein
Icon representing a puzzle

1255: Unsolved De-novo Freestyle 82: Predicted Contacts

Closed since over 9 years ago

Intermediate Overall Prediction Predicted Contacts

Summary


Created
July 04, 2016
Expires
Max points
100
Description

This is a follow-up puzzle for Puzzle 1252, now with Predicted Contacts to help guide your folding! See the blog for information on using the contact map. You can see the predicted contacts for this protein by clicking the Contact Map button in the Main menu (Selection Interface) or in the Actions tab (Classic Interface). You will notice that different contacts are shown in different shades of green, with brighter green contacts indicating stronger predictions. Players will be able to load in manual saves from Puzzle 1252 and use them as a starting point here.



Sequence:


MAASSRAQVLSLYRAMLRESKRFSAYNYRTYAVRRIRDAFRENKNVKDPVEIQTLVNKAKRDLGVIRRQVHIGQLYSTDKLIIENRDMPRT

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 12,045
  2. Avatar for Contenders 2. Contenders 65 pts. 11,898
  3. Avatar for Go Science 3. Go Science 41 pts. 11,672
  4. Avatar for Gargleblasters 4. Gargleblasters 24 pts. 11,547
  5. Avatar for Beta Folders 5. Beta Folders 14 pts. 11,534
  6. Avatar for Deleted group 6. Deleted group pts. 11,380
  7. Avatar for Void Crushers 7. Void Crushers 4 pts. 11,148
  8. Avatar for SETI.Germany 8. SETI.Germany 2 pts. 10,981
  9. Avatar for L'Alliance Francophone 9. L'Alliance Francophone 1 pt. 10,955
  10. Avatar for Deleted group 10. Deleted group pts. 10,392

  1. Avatar for gcm24 61. gcm24 Lv 1 15 pts. 10,663
  2. Avatar for hansvandenhof 62. hansvandenhof Lv 1 14 pts. 10,658
  3. Avatar for georg137 63. georg137 Lv 1 14 pts. 10,648
  4. Avatar for jobo0502 64. jobo0502 Lv 1 13 pts. 10,641
  5. Avatar for weitzen 65. weitzen Lv 1 13 pts. 10,621
  6. Avatar for Blipperman 66. Blipperman Lv 1 12 pts. 10,620
  7. Avatar for ViJay7019 67. ViJay7019 Lv 1 12 pts. 10,617
  8. Avatar for Ashrai 68. Ashrai Lv 1 11 pts. 10,546
  9. Avatar for dssb 69. dssb Lv 1 11 pts. 10,516
  10. Avatar for YGK 70. YGK Lv 1 11 pts. 10,508

Comments