Placeholder image of a protein
Icon representing a puzzle

1256: Revisiting Puzzle 60: Beta Barrel

Closed since over 9 years ago

Intermediate Overall Prediction

Summary

Created
July 06, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein binds fatty acids in intestinal cells. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AFDGTWKVDRNENYEKFMEKMGINVVKRKLGAHDNLKLTITQEGNKFTVKESSNFRNIDNVFELGVDFAYSLADGTELTGTWTMEGNKLVGKFKRVDNGKELIAVREISGNELIQTYTYEGVEAKRIFKKE

Top groups

  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 1 pt. 9,785
  2. Avatar for It's over 9000! 12. It's over 9000! 1 pt. 9,775
  3. Avatar for SETI.Germany 13. SETI.Germany 1 pt. 9,696
  4. Avatar for Deleted group 14. Deleted group pts. 9,605
  5. Avatar for DSN @ Home 15. DSN @ Home 1 pt. 9,176
  1. Avatar for emtonsti 161. emtonsti Lv 1 1 pt. 9,130
  2. Avatar for flamingjaws 162. flamingjaws Lv 1 1 pt. 9,129
  3. Avatar for Cerzax 163. Cerzax Lv 1 1 pt. 9,065
  4. Avatar for xplocast1 164. xplocast1 Lv 1 1 pt. 9,046
  5. Avatar for Blitzghost 165. Blitzghost Lv 1 1 pt. 9,023
  6. Avatar for ivalnic 166. ivalnic Lv 1 1 pt. 8,993
  7. Avatar for emdee314 167. emdee314 Lv 1 1 pt. 8,934
  8. Avatar for Maerlyn138 168. Maerlyn138 Lv 1 1 pt. 8,911
  9. Avatar for wikgwo 169. wikgwo Lv 1 1 pt. 8,739
  10. Avatar for dark_v3ng3nc3 170. dark_v3ng3nc3 Lv 1 1 pt. 8,539

Comments