Placeholder image of a protein
Icon representing a puzzle

1256: Revisiting Puzzle 60: Beta Barrel

Closed since almost 10 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
July 06, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein binds fatty acids in intestinal cells. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AFDGTWKVDRNENYEKFMEKMGINVVKRKLGAHDNLKLTITQEGNKFTVKESSNFRNIDNVFELGVDFAYSLADGTELTGTWTMEGNKLVGKFKRVDNGKELIAVREISGNELIQTYTYEGVEAKRIFKKE

Top groups


  1. Avatar for Contenders 100 pts. 10,471
  2. Avatar for Go Science 2. Go Science 70 pts. 10,468
  3. Avatar for Beta Folders 3. Beta Folders 47 pts. 10,436
  4. Avatar for Void Crushers 4. Void Crushers 30 pts. 10,412
  5. Avatar for Gargleblasters 5. Gargleblasters 19 pts. 10,404
  6. Avatar for Anthropic Dreams 6. Anthropic Dreams 11 pts. 10,323
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 7 pts. 10,277
  8. Avatar for HMT heritage 8. HMT heritage 4 pts. 9,933
  9. Avatar for xkcd 9. xkcd 2 pts. 9,897
  10. Avatar for Deleted group 10. Deleted group pts. 9,879

  1. Avatar for emtonsti 161. emtonsti Lv 1 1 pt. 9,130
  2. Avatar for flamingjaws 162. flamingjaws Lv 1 1 pt. 9,129
  3. Avatar for Cerzax 163. Cerzax Lv 1 1 pt. 9,065
  4. Avatar for xplocast1 164. xplocast1 Lv 1 1 pt. 9,046
  5. Avatar for Blitzghost 165. Blitzghost Lv 1 1 pt. 9,023
  6. Avatar for ivalnic 166. ivalnic Lv 1 1 pt. 8,993
  7. Avatar for emdee314 167. emdee314 Lv 1 1 pt. 8,934
  8. Avatar for Maerlyn138 168. Maerlyn138 Lv 1 1 pt. 8,911
  9. Avatar for wikgwo 169. wikgwo Lv 1 1 pt. 8,739
  10. Avatar for dark_v3ng3nc3 170. dark_v3ng3nc3 Lv 1 1 pt. 8,539

Comments