Placeholder image of a protein
Icon representing a puzzle

1256: Revisiting Puzzle 60: Beta Barrel

Closed since over 9 years ago

Intermediate Overall Prediction

Summary

Created
July 06, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein binds fatty acids in intestinal cells. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AFDGTWKVDRNENYEKFMEKMGINVVKRKLGAHDNLKLTITQEGNKFTVKESSNFRNIDNVFELGVDFAYSLADGTELTGTWTMEGNKLVGKFKRVDNGKELIAVREISGNELIQTYTYEGVEAKRIFKKE

Top groups

  1. Avatar for Contenders
    1. Contenders
    100 pts. 10,471
  2. Avatar for Go Science 2. Go Science 70 pts. 10,468
  3. Avatar for Beta Folders 3. Beta Folders 47 pts. 10,436
  4. Avatar for Void Crushers 4. Void Crushers 30 pts. 10,412
  5. Avatar for Gargleblasters 5. Gargleblasters 19 pts. 10,404
  6. Avatar for Anthropic Dreams 6. Anthropic Dreams 11 pts. 10,323
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 7 pts. 10,277
  8. Avatar for HMT heritage 8. HMT heritage 4 pts. 9,933
  9. Avatar for xkcd 9. xkcd 2 pts. 9,897
  10. Avatar for Deleted group 10. Deleted group pts. 9,879
  1. Avatar for free_radical 171. free_radical Lv 1 1 pt. 8,426
  2. Avatar for Dr.Niki 172. Dr.Niki Lv 1 1 pt. 8,234
  3. Avatar for BvSG2 173. BvSG2 Lv 1 1 pt. 7,935
  4. Avatar for 01010011111 174. 01010011111 Lv 1 1 pt. 7,154
  5. Avatar for BvSG4 175. BvSG4 Lv 1 1 pt. 7,001
  6. Avatar for Digitalscape 176. Digitalscape Lv 1 1 pt. 6,186
  7. Avatar for Hollinas 177. Hollinas Lv 1 1 pt. 5,206
  8. Avatar for StephDC 178. StephDC Lv 1 1 pt. 5,206
  9. Avatar for Paulo Roque 179. Paulo Roque Lv 1 1 pt. 5,206
  10. Avatar for greepski 180. greepski Lv 1 1 pt. 5,206

Comments