Placeholder image of a protein
Icon representing a puzzle

1259: Revisiting Puzzle 61: Designer Protein Top7

Closed since over 9 years ago

Intermediate Overall Prediction

Summary

Created
July 13, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein was designed by the Baker Lab in 2003, and has a topology unlike any natural protein yet discovered. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


DIQVQVNIDDNGKNFDYTYTVTTESELQKVLNELMDYIKKQGAKRVRISITARTKKEAEKFAAILIKVFAELGYNDINVTFDGDTVTVEGQL

Top groups

  1. Avatar for Deleted group 11. Deleted group pts. 9,708
  2. Avatar for SETI.Germany 12. SETI.Germany 1 pt. 9,535
  3. Avatar for It's over 9000! 13. It's over 9000! 1 pt. 9,349
  4. Avatar for DSN @ Home 14. DSN @ Home 1 pt. 9,105
  1. Avatar for LociOiling
    1. LociOiling Lv 1
    100 pts. 10,064
  2. Avatar for johnmitch 2. johnmitch Lv 1 97 pts. 10,062
  3. Avatar for reefyrob 3. reefyrob Lv 1 94 pts. 10,055
  4. Avatar for Mark- 4. Mark- Lv 1 91 pts. 10,050
  5. Avatar for Timo van der Laan 5. Timo van der Laan Lv 1 88 pts. 10,041
  6. Avatar for dembones 6. dembones Lv 1 85 pts. 10,041
  7. Avatar for jermainiac 7. jermainiac Lv 1 82 pts. 10,038
  8. Avatar for gitwut 8. gitwut Lv 1 79 pts. 10,037
  9. Avatar for bertro 9. bertro Lv 1 76 pts. 10,036
  10. Avatar for nicobul 10. nicobul Lv 1 74 pts. 10,030

Comments