1259: Revisiting Puzzle 61: Designer Protein Top7

Closed since over 9 years ago

Summary

• Created: July 13, 2016
• Expires: July 20, 2016 at 18:00 UTC
• Max points: 100

Description

This is a throwback puzzle to the early days of Foldit. This protein was designed by the Baker Lab in 2003, and has a topology unlike any natural protein yet discovered. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

DIQVQVNIDDNGKNFDYTYTVTTESELQKVLNELMDYIKKQGAKRVRISITARTKKEAEKFAAILIKVFAELGYNDINVTFDGDTVTVEGQL

Top groups

• 1. Contenders 100 pts. 10,067
• 2. Beta Folders 68 pts. 10,065
• 3. Void Crushers 44 pts. 10,041
• 4. Anthropic Dreams 27 pts. 10,039
• 5. L'Alliance Francophone 16 pts. 10,030
• 6. Gargleblasters 9 pts. 9,989
• 7. Go Science 5 pts. 9,987
• 8. HMT heritage 3 pts. 9,957
• 9. Deleted group pts. 9,913
• 10. Italiani Al Lavoro 1 pt. 9,890

Top soloists

• 1. LociOiling 100 pts. 10,064
• 2. johnmitch 97 pts. 10,062
• 3. reefyrob 94 pts. 10,055
• 4. Mark- 91 pts. 10,050
• 5. Timo van der Laan 88 pts. 10,041
• 6. dembones 85 pts. 10,041
• 7. jermainiac 82 pts. 10,038
• 8. gitwut 79 pts. 10,037
• 9. bertro 76 pts. 10,036
• 10. nicobul 74 pts. 10,030