Placeholder image of a protein
Icon representing a puzzle

1259: Revisiting Puzzle 61: Designer Protein Top7

Closed since over 9 years ago

Intermediate Overall Prediction

Summary

Created
July 13, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein was designed by the Baker Lab in 2003, and has a topology unlike any natural protein yet discovered. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


DIQVQVNIDDNGKNFDYTYTVTTESELQKVLNELMDYIKKQGAKRVRISITARTKKEAEKFAAILIKVFAELGYNDINVTFDGDTVTVEGQL

Top groups

  1. Avatar for Deleted group 11. Deleted group pts. 9,708
  2. Avatar for SETI.Germany 12. SETI.Germany 1 pt. 9,535
  3. Avatar for It's over 9000! 13. It's over 9000! 1 pt. 9,349
  4. Avatar for DSN @ Home 14. DSN @ Home 1 pt. 9,105
  1. Avatar for Bletchley Park
    1. Bletchley Park Lv 1
    100 pts. 10,067
  2. Avatar for gitwut 2. gitwut Lv 1 83 pts. 10,065
  3. Avatar for reefyrob 3. reefyrob Lv 1 69 pts. 10,065
  4. Avatar for bertro 4. bertro Lv 1 56 pts. 10,064
  5. Avatar for LociOiling 5. LociOiling Lv 1 45 pts. 10,059
  6. Avatar for retiredmichael 6. retiredmichael Lv 1 36 pts. 10,057
  7. Avatar for dembones 7. dembones Lv 1 29 pts. 10,054
  8. Avatar for mimi 8. mimi Lv 1 23 pts. 10,050
  9. Avatar for smilingone 9. smilingone Lv 1 18 pts. 10,047
  10. Avatar for Galaxie 10. Galaxie Lv 1 14 pts. 10,039

Comments