Placeholder image of a protein
Icon representing a puzzle

1259: Revisiting Puzzle 61: Designer Protein Top7

Closed since over 9 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
July 13, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein was designed by the Baker Lab in 2003, and has a topology unlike any natural protein yet discovered. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


DIQVQVNIDDNGKNFDYTYTVTTESELQKVLNELMDYIKKQGAKRVRISITARTKKEAEKFAAILIKVFAELGYNDINVTFDGDTVTVEGQL

Top groups


  1. Avatar for Contenders 100 pts. 10,067
  2. Avatar for Beta Folders 2. Beta Folders 68 pts. 10,065
  3. Avatar for Void Crushers 3. Void Crushers 44 pts. 10,041
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 27 pts. 10,039
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 16 pts. 10,030
  6. Avatar for Gargleblasters 6. Gargleblasters 9 pts. 9,989
  7. Avatar for Go Science 7. Go Science 5 pts. 9,987
  8. Avatar for HMT heritage 8. HMT heritage 3 pts. 9,957
  9. Avatar for Deleted group 9. Deleted group pts. 9,913
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 1 pt. 9,890

  1. Avatar for LociOiling
    1. LociOiling Lv 1
    100 pts. 10,064
  2. Avatar for johnmitch 2. johnmitch Lv 1 97 pts. 10,062
  3. Avatar for reefyrob 3. reefyrob Lv 1 94 pts. 10,055
  4. Avatar for Mark- 4. Mark- Lv 1 91 pts. 10,050
  5. Avatar for Timo van der Laan 5. Timo van der Laan Lv 1 88 pts. 10,041
  6. Avatar for dembones 6. dembones Lv 1 85 pts. 10,041
  7. Avatar for jermainiac 7. jermainiac Lv 1 82 pts. 10,038
  8. Avatar for gitwut 8. gitwut Lv 1 79 pts. 10,037
  9. Avatar for bertro 9. bertro Lv 1 76 pts. 10,036
  10. Avatar for nicobul 10. nicobul Lv 1 74 pts. 10,030

Comments