1259: Revisiting Puzzle 61: Designer Protein Top7
Closed since over 9 years ago
Intermediate Intermediate Overall Overall Prediction PredictionSummary
- Created
- July 13, 2016
- Expires
- Max points
- 100
This is a throwback puzzle to the early days of Foldit. This protein was designed by the Baker Lab in 2003, and has a topology unlike any natural protein yet discovered. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.
Sequence:
DIQVQVNIDDNGKNFDYTYTVTTESELQKVLNELMDYIKKQGAKRVRISITARTKKEAEKFAAILIKVFAELGYNDINVTFDGDTVTVEGQL