Placeholder image of a protein
Icon representing a puzzle

1264: Revisiting Puzzle 63: Spinach Protein

Closed since over 9 years ago

Intermediate Overall Prediction

Summary

Created
July 20, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This spinach protein is critical for photosynthesis, and participates in the electron transfer chain within the chloroplast. The protein is modeled here in the reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AAYKVTLVTPTGNVEFQCPDDVYILDAAEEEGIDLPYSCRAGSCSSCAGKLKTGSLNQDDQSFLDDDQIDEGWVLTCAAYPVSDVTIETHKKEELTA

Top groups

  1. Avatar for Russian team 11. Russian team 2 pts. 9,146
  2. Avatar for xkcd 12. xkcd 1 pt. 9,023
  3. Avatar for It's over 9000! 13. It's over 9000! 1 pt. 8,948
  4. Avatar for SETI.Germany 14. SETI.Germany 1 pt. 8,815
  5. Avatar for freefolder 15. freefolder 1 pt. 8,751
  6. Avatar for Androids 16. Androids 1 pt. 8,349
  7. Avatar for DSN @ Home 17. DSN @ Home 1 pt. 6,811
  8. Avatar for Mojo Risin' 18. Mojo Risin' 1 pt. 5,553
  1. Avatar for ViJay7019 91. ViJay7019 Lv 1 6 pts. 9,094
  2. Avatar for ecali 92. ecali Lv 1 6 pts. 9,081
  3. Avatar for Mike Lewis 93. Mike Lewis Lv 1 6 pts. 9,065
  4. Avatar for carsonfb 94. carsonfb Lv 1 5 pts. 9,057
  5. Avatar for angeltrouble 95. angeltrouble Lv 1 5 pts. 9,056
  6. Avatar for jebbiek 96. jebbiek Lv 1 5 pts. 9,034
  7. Avatar for Steven Pletsch 97. Steven Pletsch Lv 1 5 pts. 9,028
  8. Avatar for Blipperman 98. Blipperman Lv 1 5 pts. 9,027
  9. Avatar for fryguy 99. fryguy Lv 1 4 pts. 9,023
  10. Avatar for vizerot 100. vizerot Lv 1 4 pts. 9,022

Comments