1264: Revisiting Puzzle 63: Spinach Protein

Closed since over 9 years ago

Summary

• Created: July 20, 2016
• Expires: August 03, 2016 at 18:00 UTC
• Max points: 100

Description

This is a throwback puzzle to the early days of Foldit. This spinach protein is critical for photosynthesis, and participates in the electron transfer chain within the chloroplast. The protein is modeled here in the reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

AAYKVTLVTPTGNVEFQCPDDVYILDAAEEEGIDLPYSCRAGSCSSCAGKLKTGSLNQDDQSFLDDDQIDEGWVLTCAAYPVSDVTIETHKKEELTA

Top groups

• 1. Anthropic Dreams 100 pts. 9,647
• 2. Go Science 74 pts. 9,631
• 3. Contenders 54 pts. 9,623
• 4. L'Alliance Francophone 38 pts. 9,619
• 5. Beta Folders 27 pts. 9,603
• 6. Gargleblasters 18 pts. 9,582
• 7. Italiani Al Lavoro 12 pts. 9,508
• 8. HMT heritage 8 pts. 9,432
• 9. Void Crushers 5 pts. 9,377
• 10. Deleted group pts. 9,222

Top soloists

• 1. KarenCH 100 pts. 9,637
• 2. mirp 98 pts. 9,631
• 3. dembones 96 pts. 9,623
• 4. nicobul 93 pts. 9,619
• 5. LociOiling 91 pts. 9,601
• 6. mimi 89 pts. 9,599
• 7. toshiue 87 pts. 9,595
• 8. gitwut 85 pts. 9,589
• 9. Scopper 82 pts. 9,588
• 10. Mark- 80 pts. 9,582