Placeholder image of a protein
Icon representing a puzzle

1264: Revisiting Puzzle 63: Spinach Protein

Closed since over 9 years ago

Intermediate Overall Prediction

Summary

Created
July 20, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This spinach protein is critical for photosynthesis, and participates in the electron transfer chain within the chloroplast. The protein is modeled here in the reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AAYKVTLVTPTGNVEFQCPDDVYILDAAEEEGIDLPYSCRAGSCSSCAGKLKTGSLNQDDQSFLDDDQIDEGWVLTCAAYPVSDVTIETHKKEELTA

Top groups

  1. Avatar for Russian team 11. Russian team 2 pts. 9,146
  2. Avatar for xkcd 12. xkcd 1 pt. 9,023
  3. Avatar for It's over 9000! 13. It's over 9000! 1 pt. 8,948
  4. Avatar for SETI.Germany 14. SETI.Germany 1 pt. 8,815
  5. Avatar for freefolder 15. freefolder 1 pt. 8,751
  6. Avatar for Androids 16. Androids 1 pt. 8,349
  7. Avatar for DSN @ Home 17. DSN @ Home 1 pt. 6,811
  8. Avatar for Mojo Risin' 18. Mojo Risin' 1 pt. 5,553
  1. Avatar for ShyRaptor 101. ShyRaptor Lv 1 4 pts. 9,022
  2. Avatar for froggs554 102. froggs554 Lv 1 4 pts. 9,020
  3. Avatar for JUMELLE54 103. JUMELLE54 Lv 1 4 pts. 9,019
  4. Avatar for aznarog 104. aznarog Lv 1 4 pts. 9,009
  5. Avatar for taminnugget 105. taminnugget Lv 1 3 pts. 9,006
  6. Avatar for rezaefar 106. rezaefar Lv 1 3 pts. 8,988
  7. Avatar for eusair 107. eusair Lv 1 3 pts. 8,971
  8. Avatar for Arne Heessels 108. Arne Heessels Lv 1 3 pts. 8,963
  9. Avatar for rinze 109. rinze Lv 1 3 pts. 8,962
  10. Avatar for BCAA 110. BCAA Lv 1 3 pts. 8,948

Comments