Placeholder image of a protein
Icon representing a puzzle

1264: Revisiting Puzzle 63: Spinach Protein

Closed since over 9 years ago

Intermediate Overall Prediction

Summary

Created
July 20, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This spinach protein is critical for photosynthesis, and participates in the electron transfer chain within the chloroplast. The protein is modeled here in the reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AAYKVTLVTPTGNVEFQCPDDVYILDAAEEEGIDLPYSCRAGSCSSCAGKLKTGSLNQDDQSFLDDDQIDEGWVLTCAAYPVSDVTIETHKKEELTA

Top groups

  1. Avatar for Russian team 11. Russian team 2 pts. 9,146
  2. Avatar for xkcd 12. xkcd 1 pt. 9,023
  3. Avatar for It's over 9000! 13. It's over 9000! 1 pt. 8,948
  4. Avatar for SETI.Germany 14. SETI.Germany 1 pt. 8,815
  5. Avatar for freefolder 15. freefolder 1 pt. 8,751
  6. Avatar for Androids 16. Androids 1 pt. 8,349
  7. Avatar for DSN @ Home 17. DSN @ Home 1 pt. 6,811
  8. Avatar for Mojo Risin' 18. Mojo Risin' 1 pt. 5,553
  1. Avatar for XApfelX 171. XApfelX Lv 1 1 pt. 5,493
  2. Avatar for 5438hh318 172. 5438hh318 Lv 1 1 pt. 5,479
  3. Avatar for Jizeus 173. Jizeus Lv 1 1 pt. 5,446
  4. Avatar for lightnir 174. lightnir Lv 1 1 pt. 5,426
  5. Avatar for john_proton 175. john_proton Lv 1 1 pt. 5,422
  6. Avatar for NotJim99 176. NotJim99 Lv 1 1 pt. 5,416
  7. Avatar for ArmoredCarbon 177. ArmoredCarbon Lv 1 1 pt. 5,416
  8. Avatar for t0903591 178. t0903591 Lv 1 1 pt. 5,401
  9. Avatar for NinguLilium 179. NinguLilium Lv 1 1 pt. 5,377
  10. Avatar for Tac1 180. Tac1 Lv 1 1 pt. 5,369

Comments