Placeholder image of a protein
Icon representing a puzzle

1264: Revisiting Puzzle 63: Spinach Protein

Closed since over 9 years ago

Intermediate Overall Prediction

Summary

Created
July 20, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This spinach protein is critical for photosynthesis, and participates in the electron transfer chain within the chloroplast. The protein is modeled here in the reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AAYKVTLVTPTGNVEFQCPDDVYILDAAEEEGIDLPYSCRAGSCSSCAGKLKTGSLNQDDQSFLDDDQIDEGWVLTCAAYPVSDVTIETHKKEELTA

Top groups

  1. Avatar for Russian team 11. Russian team 2 pts. 9,146
  2. Avatar for xkcd 12. xkcd 1 pt. 9,023
  3. Avatar for It's over 9000! 13. It's over 9000! 1 pt. 8,948
  4. Avatar for SETI.Germany 14. SETI.Germany 1 pt. 8,815
  5. Avatar for freefolder 15. freefolder 1 pt. 8,751
  6. Avatar for Androids 16. Androids 1 pt. 8,349
  7. Avatar for DSN @ Home 17. DSN @ Home 1 pt. 6,811
  8. Avatar for Mojo Risin' 18. Mojo Risin' 1 pt. 5,553
  1. Avatar for Tehnologik1 181. Tehnologik1 Lv 1 1 pt. 5,330
  2. Avatar for daito 182. daito Lv 1 1 pt. 5,320
  3. Avatar for cnhrcolemam 183. cnhrcolemam Lv 1 1 pt. 5,312
  4. Avatar for Janeway 184. Janeway Lv 1 1 pt. 5,288
  5. Avatar for GreenSlugg 185. GreenSlugg Lv 1 1 pt. 5,265
  6. Avatar for sharondipity 186. sharondipity Lv 1 1 pt. 5,229
  7. Avatar for girltano 187. girltano Lv 1 1 pt. 5,223
  8. Avatar for kvasirthewise 188. kvasirthewise Lv 1 1 pt. 5,179
  9. Avatar for Dicatoro 189. Dicatoro Lv 1 1 pt. 5,178
  10. Avatar for rossco0407 190. rossco0407 Lv 1 1 pt. 5,149

Comments