Placeholder image of a protein
Icon representing a puzzle

1264: Revisiting Puzzle 63: Spinach Protein

Closed since over 9 years ago

Intermediate Overall Prediction

Summary

Created
July 20, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This spinach protein is critical for photosynthesis, and participates in the electron transfer chain within the chloroplast. The protein is modeled here in the reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AAYKVTLVTPTGNVEFQCPDDVYILDAAEEEGIDLPYSCRAGSCSSCAGKLKTGSLNQDDQSFLDDDQIDEGWVLTCAAYPVSDVTIETHKKEELTA

Top groups

  1. Avatar for Russian team 11. Russian team 2 pts. 9,146
  2. Avatar for xkcd 12. xkcd 1 pt. 9,023
  3. Avatar for It's over 9000! 13. It's over 9000! 1 pt. 8,948
  4. Avatar for SETI.Germany 14. SETI.Germany 1 pt. 8,815
  5. Avatar for freefolder 15. freefolder 1 pt. 8,751
  6. Avatar for Androids 16. Androids 1 pt. 8,349
  7. Avatar for DSN @ Home 17. DSN @ Home 1 pt. 6,811
  8. Avatar for Mojo Risin' 18. Mojo Risin' 1 pt. 5,553
  1. Avatar for jobo0502 51. jobo0502 Lv 1 25 pts. 9,318
  2. Avatar for grogar7 52. grogar7 Lv 1 24 pts. 9,318
  3. Avatar for Bletchley Park 53. Bletchley Park Lv 1 24 pts. 9,290
  4. Avatar for smholst 54. smholst Lv 1 23 pts. 9,284
  5. Avatar for Vinara 55. Vinara Lv 1 22 pts. 9,279
  6. Avatar for hansvandenhof 56. hansvandenhof Lv 1 21 pts. 9,278
  7. Avatar for actiasluna 57. actiasluna Lv 1 21 pts. 9,274
  8. Avatar for deLaCeiba 58. deLaCeiba Lv 1 20 pts. 9,268
  9. Avatar for bendbob 59. bendbob Lv 1 19 pts. 9,264
  10. Avatar for georg137 60. georg137 Lv 1 19 pts. 9,264

Comments