Placeholder image of a protein
Icon representing a puzzle

1264: Revisiting Puzzle 63: Spinach Protein

Closed since over 9 years ago

Intermediate Overall Prediction

Summary

Created
July 20, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This spinach protein is critical for photosynthesis, and participates in the electron transfer chain within the chloroplast. The protein is modeled here in the reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AAYKVTLVTPTGNVEFQCPDDVYILDAAEEEGIDLPYSCRAGSCSSCAGKLKTGSLNQDDQSFLDDDQIDEGWVLTCAAYPVSDVTIETHKKEELTA

Top groups

  1. Avatar for Russian team 11. Russian team 2 pts. 9,146
  2. Avatar for xkcd 12. xkcd 1 pt. 9,023
  3. Avatar for It's over 9000! 13. It's over 9000! 1 pt. 8,948
  4. Avatar for SETI.Germany 14. SETI.Germany 1 pt. 8,815
  5. Avatar for freefolder 15. freefolder 1 pt. 8,751
  6. Avatar for Androids 16. Androids 1 pt. 8,349
  7. Avatar for DSN @ Home 17. DSN @ Home 1 pt. 6,811
  8. Avatar for Mojo Risin' 18. Mojo Risin' 1 pt. 5,553
  1. Avatar for shettler 61. shettler Lv 1 18 pts. 9,262
  2. Avatar for sheerbliss 62. sheerbliss Lv 1 18 pts. 9,258
  3. Avatar for dssb 63. dssb Lv 1 17 pts. 9,250
  4. Avatar for stomjoh 64. stomjoh Lv 1 16 pts. 9,248
  5. Avatar for gurch 65. gurch Lv 1 16 pts. 9,244
  6. Avatar for Merf 66. Merf Lv 1 15 pts. 9,238
  7. Avatar for leehaggis 67. leehaggis Lv 1 15 pts. 9,229
  8. Avatar for alrianne 68. alrianne Lv 1 14 pts. 9,225
  9. Avatar for drumpeter18yrs9yrs 69. drumpeter18yrs9yrs Lv 1 14 pts. 9,222
  10. Avatar for Jesse Pinkman 70. Jesse Pinkman Lv 1 13 pts. 9,218

Comments