Placeholder image of a protein
Icon representing a puzzle

1264: Revisiting Puzzle 63: Spinach Protein

Closed since over 9 years ago

Intermediate Overall Prediction

Summary

Created
July 20, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This spinach protein is critical for photosynthesis, and participates in the electron transfer chain within the chloroplast. The protein is modeled here in the reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AAYKVTLVTPTGNVEFQCPDDVYILDAAEEEGIDLPYSCRAGSCSSCAGKLKTGSLNQDDQSFLDDDQIDEGWVLTCAAYPVSDVTIETHKKEELTA

Top groups

  1. Avatar for Russian team 11. Russian team 2 pts. 9,146
  2. Avatar for xkcd 12. xkcd 1 pt. 9,023
  3. Avatar for It's over 9000! 13. It's over 9000! 1 pt. 8,948
  4. Avatar for SETI.Germany 14. SETI.Germany 1 pt. 8,815
  5. Avatar for freefolder 15. freefolder 1 pt. 8,751
  6. Avatar for Androids 16. Androids 1 pt. 8,349
  7. Avatar for DSN @ Home 17. DSN @ Home 1 pt. 6,811
  8. Avatar for Mojo Risin' 18. Mojo Risin' 1 pt. 5,553
  1. Avatar for alwen 71. alwen Lv 1 13 pts. 9,215
  2. Avatar for guineapig 72. guineapig Lv 1 12 pts. 9,213
  3. Avatar for diamonddays 73. diamonddays Lv 1 12 pts. 9,211
  4. Avatar for dcrwheeler 74. dcrwheeler Lv 1 12 pts. 9,208
  5. Avatar for spvincent 75. spvincent Lv 1 11 pts. 9,201
  6. Avatar for harvardman 76. harvardman Lv 1 11 pts. 9,197
  7. Avatar for caglar 77. caglar Lv 1 10 pts. 9,196
  8. Avatar for senor pit 78. senor pit Lv 1 10 pts. 9,181
  9. Avatar for altejoh 79. altejoh Lv 1 10 pts. 9,177
  10. Avatar for matosfran 80. matosfran Lv 1 9 pts. 9,177

Comments