Placeholder image of a protein
Icon representing a puzzle

1264: Revisiting Puzzle 63: Spinach Protein

Closed since over 9 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
July 20, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This spinach protein is critical for photosynthesis, and participates in the electron transfer chain within the chloroplast. The protein is modeled here in the reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AAYKVTLVTPTGNVEFQCPDDVYILDAAEEEGIDLPYSCRAGSCSSCAGKLKTGSLNQDDQSFLDDDQIDEGWVLTCAAYPVSDVTIETHKKEELTA

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 9,647
  2. Avatar for Go Science 2. Go Science 74 pts. 9,631
  3. Avatar for Contenders 3. Contenders 54 pts. 9,623
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 38 pts. 9,619
  5. Avatar for Beta Folders 5. Beta Folders 27 pts. 9,603
  6. Avatar for Gargleblasters 6. Gargleblasters 18 pts. 9,582
  7. Avatar for Italiani Al Lavoro 7. Italiani Al Lavoro 12 pts. 9,508
  8. Avatar for HMT heritage 8. HMT heritage 8 pts. 9,432
  9. Avatar for Void Crushers 9. Void Crushers 5 pts. 9,377
  10. Avatar for Deleted group 10. Deleted group pts. 9,222

  1. Avatar for ViJay7019 91. ViJay7019 Lv 1 6 pts. 9,094
  2. Avatar for ecali 92. ecali Lv 1 6 pts. 9,081
  3. Avatar for Mike Lewis 93. Mike Lewis Lv 1 6 pts. 9,065
  4. Avatar for carsonfb 94. carsonfb Lv 1 5 pts. 9,057
  5. Avatar for angeltrouble 95. angeltrouble Lv 1 5 pts. 9,056
  6. Avatar for jebbiek 96. jebbiek Lv 1 5 pts. 9,034
  7. Avatar for Steven Pletsch 97. Steven Pletsch Lv 1 5 pts. 9,028
  8. Avatar for Blipperman 98. Blipperman Lv 1 5 pts. 9,027
  9. Avatar for fryguy 99. fryguy Lv 1 4 pts. 9,023
  10. Avatar for vizerot 100. vizerot Lv 1 4 pts. 9,022

Comments