Placeholder image of a protein
Icon representing a puzzle

1264: Revisiting Puzzle 63: Spinach Protein

Closed since almost 10 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
July 20, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This spinach protein is critical for photosynthesis, and participates in the electron transfer chain within the chloroplast. The protein is modeled here in the reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AAYKVTLVTPTGNVEFQCPDDVYILDAAEEEGIDLPYSCRAGSCSSCAGKLKTGSLNQDDQSFLDDDQIDEGWVLTCAAYPVSDVTIETHKKEELTA

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 9,647
  2. Avatar for Go Science 2. Go Science 74 pts. 9,631
  3. Avatar for Contenders 3. Contenders 54 pts. 9,623
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 38 pts. 9,619
  5. Avatar for Beta Folders 5. Beta Folders 27 pts. 9,603
  6. Avatar for Gargleblasters 6. Gargleblasters 18 pts. 9,582
  7. Avatar for Italiani Al Lavoro 7. Italiani Al Lavoro 12 pts. 9,508
  8. Avatar for HMT heritage 8. HMT heritage 8 pts. 9,432
  9. Avatar for Void Crushers 9. Void Crushers 5 pts. 9,377
  10. Avatar for Deleted group 10. Deleted group pts. 9,222

  1. Avatar for K4rlos 161. K4rlos Lv 1 1 pt. 5,648
  2. Avatar for meatexplosion 162. meatexplosion Lv 1 1 pt. 5,639
  3. Avatar for guezzy 163. guezzy Lv 1 1 pt. 5,563
  4. Avatar for Tlaloc 164. Tlaloc Lv 1 1 pt. 5,553
  5. Avatar for krudolph 165. krudolph Lv 1 1 pt. 5,540
  6. Avatar for Cerzax 166. Cerzax Lv 1 1 pt. 5,514
  7. Avatar for Nusayr 167. Nusayr Lv 1 1 pt. 5,513
  8. Avatar for GoodGuyGreg 168. GoodGuyGreg Lv 1 1 pt. 5,502
  9. Avatar for Anamfija 169. Anamfija Lv 1 1 pt. 5,500
  10. Avatar for Thesilverlight 170. Thesilverlight Lv 1 1 pt. 5,497

Comments