Placeholder image of a protein
Icon representing a puzzle

1267: Revisiting Puzzle 64: Thioredoxin

Closed since over 9 years ago

Intermediate Overall Prediction

Summary


Created
August 03, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This human protein helps to regulate the reduction potential of the cell, and should be modeled here in reduced form (with no disulfide bonds). We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVNDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV

Top groups


  1. Avatar for Bad Monkey 11. Bad Monkey 1 pt. 9,885
  2. Avatar for It's over 9000! 12. It's over 9000! 1 pt. 9,791
  3. Avatar for xkcd 13. xkcd 1 pt. 9,717
  4. Avatar for freefolder 14. freefolder 1 pt. 9,659
  5. Avatar for SETI.Germany 15. SETI.Germany 1 pt. 9,492
  6. Avatar for DSN @ Home 16. DSN @ Home 1 pt. 9,456
  7. Avatar for Team South Africa 17. Team South Africa 1 pt. 9,410

  1. Avatar for Hollinas 91. Hollinas Lv 1 5 pts. 9,780
  2. Avatar for pandapharmd 92. pandapharmd Lv 1 4 pts. 9,775
  3. Avatar for Dempy 93. Dempy Lv 1 4 pts. 9,774
  4. Avatar for phi16 94. phi16 Lv 1 4 pts. 9,770
  5. Avatar for tarimo 95. tarimo Lv 1 4 pts. 9,767
  6. Avatar for joaniegirl 96. joaniegirl Lv 1 4 pts. 9,766
  7. Avatar for mitarcher 97. mitarcher Lv 1 4 pts. 9,762
  8. Avatar for jermainiac 98. jermainiac Lv 1 3 pts. 9,761
  9. Avatar for Aikuiba 99. Aikuiba Lv 1 3 pts. 9,755
  10. Avatar for Vinara 100. Vinara Lv 1 3 pts. 9,750

Comments