1267: Revisiting Puzzle 64: Thioredoxin

Closed since over 9 years ago

Summary

• Created: August 03, 2016
• Expires: August 10, 2016 at 18:00 UTC
• Max points: 100

Description

This is a throwback puzzle to the early days of Foldit. This human protein helps to regulate the reduction potential of the cell, and should be modeled here in reduced form (with no disulfide bonds). We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVNDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV

Top groups

• 1. Beta Folders 100 pts. 10,004
• 2. Contenders 73 pts. 9,977
• 3. Go Science 52 pts. 9,972
• 4. Anthropic Dreams 36 pts. 9,960
• 5. Void Crushers 24 pts. 9,954
• 6. Gargleblasters 16 pts. 9,954
• 7. HMT heritage 10 pts. 9,947
• 8. L'Alliance Francophone 6 pts. 9,932
• 9. Deleted group pts. 9,929
• 10. Italiani Al Lavoro 2 pts. 9,892

Top soloists

• 1. bertro 100 pts. 9,988
• 2. Bletchley Park 98 pts. 9,977
• 3. Aubade01 95 pts. 9,968
• 4. Bruno Kestemont 93 pts. 9,967
• 5. pauldunn 90 pts. 9,967
• 6. mirp 88 pts. 9,965
• 7. mimi 86 pts. 9,964
• 8. gitwut 83 pts. 9,963
• 9. Deleted player pts. 9,962
• 10. LociOiling 79 pts. 9,962