Placeholder image of a protein
Icon representing a puzzle

1267: Revisiting Puzzle 64: Thioredoxin

Closed since over 9 years ago

Intermediate Overall Prediction

Summary

Created
August 03, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This human protein helps to regulate the reduction potential of the cell, and should be modeled here in reduced form (with no disulfide bonds). We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVNDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV

Top groups

  1. Avatar for Bad Monkey 11. Bad Monkey 1 pt. 9,885
  2. Avatar for It's over 9000! 12. It's over 9000! 1 pt. 9,791
  3. Avatar for xkcd 13. xkcd 1 pt. 9,717
  4. Avatar for freefolder 14. freefolder 1 pt. 9,659
  5. Avatar for SETI.Germany 15. SETI.Germany 1 pt. 9,492
  6. Avatar for DSN @ Home 16. DSN @ Home 1 pt. 9,456
  7. Avatar for Team South Africa 17. Team South Africa 1 pt. 9,410
  1. Avatar for froggs554 101. froggs554 Lv 1 3 pts. 9,739
  2. Avatar for heather-1 102. heather-1 Lv 1 3 pts. 9,735
  3. Avatar for NinjaGreg 103. NinjaGreg Lv 1 3 pts. 9,733
  4. Avatar for harvardman 104. harvardman Lv 1 3 pts. 9,732
  5. Avatar for TastyMunchies 105. TastyMunchies Lv 1 2 pts. 9,730
  6. Avatar for martinf 106. martinf Lv 1 2 pts. 9,723
  7. Avatar for jebbiek 107. jebbiek Lv 1 2 pts. 9,721
  8. Avatar for fryguy 108. fryguy Lv 1 2 pts. 9,717
  9. Avatar for No_Idea 109. No_Idea Lv 1 2 pts. 9,710
  10. Avatar for grogar7 110. grogar7 Lv 1 2 pts. 9,710

Comments