Placeholder image of a protein
Icon representing a puzzle

1267: Revisiting Puzzle 64: Thioredoxin

Closed since over 9 years ago

Intermediate Overall Prediction

Summary

Created
August 03, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This human protein helps to regulate the reduction potential of the cell, and should be modeled here in reduced form (with no disulfide bonds). We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVNDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV

Top groups

  1. Avatar for Bad Monkey 11. Bad Monkey 1 pt. 9,885
  2. Avatar for It's over 9000! 12. It's over 9000! 1 pt. 9,791
  3. Avatar for xkcd 13. xkcd 1 pt. 9,717
  4. Avatar for freefolder 14. freefolder 1 pt. 9,659
  5. Avatar for SETI.Germany 15. SETI.Germany 1 pt. 9,492
  6. Avatar for DSN @ Home 16. DSN @ Home 1 pt. 9,456
  7. Avatar for Team South Africa 17. Team South Africa 1 pt. 9,410
  1. Avatar for egran48 121. egran48 Lv 1 1 pt. 9,647
  2. Avatar for nemo7731 122. nemo7731 Lv 1 1 pt. 9,643
  3. Avatar for gurch 123. gurch Lv 1 1 pt. 9,636
  4. Avatar for poiuyqwert 124. poiuyqwert Lv 1 1 pt. 9,632
  5. Avatar for leannerikicheever 125. leannerikicheever Lv 1 1 pt. 9,619
  6. Avatar for dam_01 126. dam_01 Lv 1 1 pt. 9,612
  7. Avatar for Squirrely 127. Squirrely Lv 1 1 pt. 9,610
  8. Avatar for Maru67 128. Maru67 Lv 1 1 pt. 9,610
  9. Avatar for senor pit 129. senor pit Lv 1 1 pt. 9,607
  10. Avatar for Tehnologik1 130. Tehnologik1 Lv 1 1 pt. 9,601

Comments