Placeholder image of a protein
Icon representing a puzzle

1267: Revisiting Puzzle 64: Thioredoxin

Closed since over 9 years ago

Intermediate Overall Prediction

Summary

Created
August 03, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This human protein helps to regulate the reduction potential of the cell, and should be modeled here in reduced form (with no disulfide bonds). We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVNDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV

Top groups

  1. Avatar for Bad Monkey 11. Bad Monkey 1 pt. 9,885
  2. Avatar for It's over 9000! 12. It's over 9000! 1 pt. 9,791
  3. Avatar for xkcd 13. xkcd 1 pt. 9,717
  4. Avatar for freefolder 14. freefolder 1 pt. 9,659
  5. Avatar for SETI.Germany 15. SETI.Germany 1 pt. 9,492
  6. Avatar for DSN @ Home 16. DSN @ Home 1 pt. 9,456
  7. Avatar for Team South Africa 17. Team South Africa 1 pt. 9,410
  1. Avatar for Pietro MSB 151. Pietro MSB Lv 1 1 pt. 9,540
  2. Avatar for lightnir 152. lightnir Lv 1 1 pt. 9,540
  3. Avatar for kadaverzian 153. kadaverzian Lv 1 1 pt. 9,532
  4. Avatar for momadoc 154. momadoc Lv 1 1 pt. 9,531
  5. Avatar for placid.lion 155. placid.lion Lv 1 1 pt. 9,527
  6. Avatar for alamar 156. alamar Lv 1 1 pt. 9,526
  7. Avatar for Alex333 157. Alex333 Lv 1 1 pt. 9,512
  8. Avatar for lockert 158. lockert Lv 1 1 pt. 9,510
  9. Avatar for navn 159. navn Lv 1 1 pt. 9,506
  10. Avatar for ManVsYard 160. ManVsYard Lv 1 1 pt. 9,502

Comments