Placeholder image of a protein
Icon representing a puzzle

1267: Revisiting Puzzle 64: Thioredoxin

Closed since over 9 years ago

Intermediate Overall Prediction

Summary

Created
August 03, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This human protein helps to regulate the reduction potential of the cell, and should be modeled here in reduced form (with no disulfide bonds). We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVNDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV

Top groups

  1. Avatar for Bad Monkey 11. Bad Monkey 1 pt. 9,885
  2. Avatar for It's over 9000! 12. It's over 9000! 1 pt. 9,791
  3. Avatar for xkcd 13. xkcd 1 pt. 9,717
  4. Avatar for freefolder 14. freefolder 1 pt. 9,659
  5. Avatar for SETI.Germany 15. SETI.Germany 1 pt. 9,492
  6. Avatar for DSN @ Home 16. DSN @ Home 1 pt. 9,456
  7. Avatar for Team South Africa 17. Team South Africa 1 pt. 9,410
  1. Avatar for cascio 161. cascio Lv 1 1 pt. 9,495
  2. Avatar for HMK 162. HMK Lv 1 1 pt. 9,492
  3. Avatar for inkycatz 163. inkycatz Lv 1 1 pt. 9,485
  4. Avatar for NotJim99 164. NotJim99 Lv 1 1 pt. 9,479
  5. Avatar for aendgraend 165. aendgraend Lv 1 1 pt. 9,471
  6. Avatar for Oreliel 166. Oreliel Lv 1 1 pt. 9,468
  7. Avatar for aspadistra 167. aspadistra Lv 1 1 pt. 9,456
  8. Avatar for Deleted player 168. Deleted player pts. 9,448
  9. Avatar for xvchhrth 169. xvchhrth Lv 1 1 pt. 9,445
  10. Avatar for saramickey 170. saramickey Lv 1 1 pt. 9,443

Comments