Placeholder image of a protein
Icon representing a puzzle

1267: Revisiting Puzzle 64: Thioredoxin

Closed since over 9 years ago

Intermediate Overall Prediction

Summary

Created
August 03, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This human protein helps to regulate the reduction potential of the cell, and should be modeled here in reduced form (with no disulfide bonds). We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVNDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV

Top groups

  1. Avatar for Bad Monkey 11. Bad Monkey 1 pt. 9,885
  2. Avatar for It's over 9000! 12. It's over 9000! 1 pt. 9,791
  3. Avatar for xkcd 13. xkcd 1 pt. 9,717
  4. Avatar for freefolder 14. freefolder 1 pt. 9,659
  5. Avatar for SETI.Germany 15. SETI.Germany 1 pt. 9,492
  6. Avatar for DSN @ Home 16. DSN @ Home 1 pt. 9,456
  7. Avatar for Team South Africa 17. Team South Africa 1 pt. 9,410
  1. Avatar for mirjamvandelft 171. mirjamvandelft Lv 1 1 pt. 9,443
  2. Avatar for kvasirthewise 172. kvasirthewise Lv 1 1 pt. 9,441
  3. Avatar for zkk518 173. zkk518 Lv 1 1 pt. 9,435
  4. Avatar for tweak64 174. tweak64 Lv 1 1 pt. 9,428
  5. Avatar for doctaven 175. doctaven Lv 1 1 pt. 9,410
  6. Avatar for DotMatrix 176. DotMatrix Lv 1 1 pt. 9,408
  7. Avatar for Liebert 177. Liebert Lv 1 1 pt. 9,401
  8. Avatar for tomo.inobe 178. tomo.inobe Lv 1 1 pt. 9,396
  9. Avatar for mutatione 179. mutatione Lv 1 1 pt. 9,368
  10. Avatar for dbuske 180. dbuske Lv 1 1 pt. 9,281

Comments