Placeholder image of a protein
Icon representing a puzzle

1267: Revisiting Puzzle 64: Thioredoxin

Closed since over 9 years ago

Intermediate Overall Prediction

Summary

Created
August 03, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This human protein helps to regulate the reduction potential of the cell, and should be modeled here in reduced form (with no disulfide bonds). We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVNDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV

Top groups

  1. Avatar for Bad Monkey 11. Bad Monkey 1 pt. 9,885
  2. Avatar for It's over 9000! 12. It's over 9000! 1 pt. 9,791
  3. Avatar for xkcd 13. xkcd 1 pt. 9,717
  4. Avatar for freefolder 14. freefolder 1 pt. 9,659
  5. Avatar for SETI.Germany 15. SETI.Germany 1 pt. 9,492
  6. Avatar for DSN @ Home 16. DSN @ Home 1 pt. 9,456
  7. Avatar for Team South Africa 17. Team South Africa 1 pt. 9,410
  1. Avatar for ivalnic 181. ivalnic Lv 1 1 pt. 9,259
  2. Avatar for bendbob 182. bendbob Lv 1 1 pt. 9,188
  3. Avatar for Jumbly 183. Jumbly Lv 1 1 pt. 9,105
  4. Avatar for Zuhayr 184. Zuhayr Lv 1 1 pt. 8,972
  5. Avatar for Simek 185. Simek Lv 1 1 pt. 8,930
  6. Avatar for RAH 186. RAH Lv 1 1 pt. 8,085
  7. Avatar for 01010011111 187. 01010011111 Lv 1 1 pt. 7,410
  8. Avatar for gdnskye 188. gdnskye Lv 1 1 pt. 7,353
  9. Avatar for DarkShadow44 189. DarkShadow44 Lv 1 1 pt. 7,353
  10. Avatar for emtonsti 190. emtonsti Lv 1 1 pt. 7,353

Comments