Placeholder image of a protein
Icon representing a puzzle

1267: Revisiting Puzzle 64: Thioredoxin

Closed since over 9 years ago

Intermediate Overall Prediction

Summary


Created
August 03, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This human protein helps to regulate the reduction potential of the cell, and should be modeled here in reduced form (with no disulfide bonds). We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVNDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV

Top groups


  1. Avatar for Bad Monkey 11. Bad Monkey 1 pt. 9,885
  2. Avatar for It's over 9000! 12. It's over 9000! 1 pt. 9,791
  3. Avatar for xkcd 13. xkcd 1 pt. 9,717
  4. Avatar for freefolder 14. freefolder 1 pt. 9,659
  5. Avatar for SETI.Germany 15. SETI.Germany 1 pt. 9,492
  6. Avatar for DSN @ Home 16. DSN @ Home 1 pt. 9,456
  7. Avatar for Team South Africa 17. Team South Africa 1 pt. 9,410

  1. Avatar for IrelandMarc 51. IrelandMarc Lv 1 22 pts. 9,906
  2. Avatar for fiendish_ghoul 52. fiendish_ghoul Lv 1 22 pts. 9,903
  3. Avatar for diamonddays 53. diamonddays Lv 1 21 pts. 9,900
  4. Avatar for Merf 54. Merf Lv 1 20 pts. 9,893
  5. Avatar for eromana 55. eromana Lv 1 19 pts. 9,892
  6. Avatar for deLaCeiba 56. deLaCeiba Lv 1 19 pts. 9,892
  7. Avatar for Ashrai 57. Ashrai Lv 1 18 pts. 9,891
  8. Avatar for dizzywings 58. dizzywings Lv 1 17 pts. 9,890
  9. Avatar for frood66 59. frood66 Lv 1 17 pts. 9,890
  10. Avatar for weitzen 60. weitzen Lv 1 16 pts. 9,885

Comments