Placeholder image of a protein
Icon representing a puzzle

1267: Revisiting Puzzle 64: Thioredoxin

Closed since over 9 years ago

Intermediate Overall Prediction

Summary


Created
August 03, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This human protein helps to regulate the reduction potential of the cell, and should be modeled here in reduced form (with no disulfide bonds). We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVNDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV

Top groups


  1. Avatar for Bad Monkey 11. Bad Monkey 1 pt. 9,885
  2. Avatar for It's over 9000! 12. It's over 9000! 1 pt. 9,791
  3. Avatar for xkcd 13. xkcd 1 pt. 9,717
  4. Avatar for freefolder 14. freefolder 1 pt. 9,659
  5. Avatar for SETI.Germany 15. SETI.Germany 1 pt. 9,492
  6. Avatar for DSN @ Home 16. DSN @ Home 1 pt. 9,456
  7. Avatar for Team South Africa 17. Team South Africa 1 pt. 9,410

  1. Avatar for MattTheGeek 61. MattTheGeek Lv 1 16 pts. 9,885
  2. Avatar for ecali 62. ecali Lv 1 15 pts. 9,883
  3. Avatar for Satina 63. Satina Lv 1 15 pts. 9,882
  4. Avatar for dssb 64. dssb Lv 1 14 pts. 9,880
  5. Avatar for TomTaylor 65. TomTaylor Lv 1 13 pts. 9,876
  6. Avatar for alwen 66. alwen Lv 1 13 pts. 9,874
  7. Avatar for hansvandenhof 67. hansvandenhof Lv 1 13 pts. 9,873
  8. Avatar for Glen B 68. Glen B Lv 1 12 pts. 9,865
  9. Avatar for Anfinsen_slept_here 69. Anfinsen_slept_here Lv 1 12 pts. 9,863
  10. Avatar for Jim Fraser 70. Jim Fraser Lv 1 11 pts. 9,862

Comments