Placeholder image of a protein
Icon representing a puzzle

1267: Revisiting Puzzle 64: Thioredoxin

Closed since over 9 years ago

Intermediate Overall Prediction

Summary


Created
August 03, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This human protein helps to regulate the reduction potential of the cell, and should be modeled here in reduced form (with no disulfide bonds). We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVNDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV

Top groups


  1. Avatar for Bad Monkey 11. Bad Monkey 1 pt. 9,885
  2. Avatar for It's over 9000! 12. It's over 9000! 1 pt. 9,791
  3. Avatar for xkcd 13. xkcd 1 pt. 9,717
  4. Avatar for freefolder 14. freefolder 1 pt. 9,659
  5. Avatar for SETI.Germany 15. SETI.Germany 1 pt. 9,492
  6. Avatar for DSN @ Home 16. DSN @ Home 1 pt. 9,456
  7. Avatar for Team South Africa 17. Team South Africa 1 pt. 9,410

  1. Avatar for SouperGenious 71. SouperGenious Lv 1 11 pts. 9,853
  2. Avatar for smholst 72. smholst Lv 1 10 pts. 9,846
  3. Avatar for cherry39 73. cherry39 Lv 1 10 pts. 9,846
  4. Avatar for Deleted player 74. Deleted player pts. 9,846
  5. Avatar for aznarog 75. aznarog Lv 1 9 pts. 9,845
  6. Avatar for Punktchen 76. Punktchen Lv 1 9 pts. 9,838
  7. Avatar for stomjoh 77. stomjoh Lv 1 8 pts. 9,836
  8. Avatar for johngran 78. johngran Lv 1 8 pts. 9,824
  9. Avatar for rezaefar 79. rezaefar Lv 1 8 pts. 9,824
  10. Avatar for Idiotboy 80. Idiotboy Lv 1 7 pts. 9,813

Comments