Placeholder image of a protein
Icon representing a puzzle

1267: Revisiting Puzzle 64: Thioredoxin

Closed since over 9 years ago

Intermediate Overall Prediction

Summary

Created
August 03, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This human protein helps to regulate the reduction potential of the cell, and should be modeled here in reduced form (with no disulfide bonds). We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVNDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV

Top groups

  1. Avatar for Bad Monkey 11. Bad Monkey 1 pt. 9,885
  2. Avatar for It's over 9000! 12. It's over 9000! 1 pt. 9,791
  3. Avatar for xkcd 13. xkcd 1 pt. 9,717
  4. Avatar for freefolder 14. freefolder 1 pt. 9,659
  5. Avatar for SETI.Germany 15. SETI.Germany 1 pt. 9,492
  6. Avatar for DSN @ Home 16. DSN @ Home 1 pt. 9,456
  7. Avatar for Team South Africa 17. Team South Africa 1 pt. 9,410
  1. Avatar for uihcv 81. uihcv Lv 1 7 pts. 9,812
  2. Avatar for sheerbliss 82. sheerbliss Lv 1 7 pts. 9,812
  3. Avatar for JUMELLE54 83. JUMELLE54 Lv 1 7 pts. 9,807
  4. Avatar for ppp6 84. ppp6 Lv 1 6 pts. 9,802
  5. Avatar for caglar 85. caglar Lv 1 6 pts. 9,802
  6. Avatar for georg137 86. georg137 Lv 1 6 pts. 9,801
  7. Avatar for Marvelz 87. Marvelz Lv 1 6 pts. 9,801
  8. Avatar for altejoh 88. altejoh Lv 1 5 pts. 9,795
  9. Avatar for ViJay7019 89. ViJay7019 Lv 1 5 pts. 9,794
  10. Avatar for BCAA 90. BCAA Lv 1 5 pts. 9,791

Comments