Placeholder image of a protein
Icon representing a puzzle

1267: Revisiting Puzzle 64: Thioredoxin

Closed since almost 10 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
August 03, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This human protein helps to regulate the reduction potential of the cell, and should be modeled here in reduced form (with no disulfide bonds). We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVNDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV

Top groups


  1. Avatar for Beta Folders 100 pts. 10,004
  2. Avatar for Contenders 2. Contenders 73 pts. 9,977
  3. Avatar for Go Science 3. Go Science 52 pts. 9,972
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 36 pts. 9,960
  5. Avatar for Void Crushers 5. Void Crushers 24 pts. 9,954
  6. Avatar for Gargleblasters 6. Gargleblasters 16 pts. 9,954
  7. Avatar for HMT heritage 7. HMT heritage 10 pts. 9,947
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 6 pts. 9,932
  9. Avatar for Deleted group 9. Deleted group pts. 9,929
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 2 pts. 9,892

  1. Avatar for Scopper 11. Scopper Lv 1 11 pts. 9,964
  2. Avatar for Galaxie 12. Galaxie Lv 1 9 pts. 9,960
  3. Avatar for mimi 13. mimi Lv 1 7 pts. 9,957
  4. Avatar for ManVsYard 14. ManVsYard Lv 1 5 pts. 9,954
  5. Avatar for lamoille 15. lamoille Lv 1 4 pts. 9,952
  6. Avatar for Skippysk8s 16. Skippysk8s Lv 1 3 pts. 9,952
  7. Avatar for actiasluna 17. actiasluna Lv 1 2 pts. 9,951
  8. Avatar for dembones 18. dembones Lv 1 1 pt. 9,946
  9. Avatar for Blipperman 19. Blipperman Lv 1 1 pt. 9,946
  10. Avatar for Norrjane 20. Norrjane Lv 1 1 pt. 9,945

Comments