Placeholder image of a protein
Icon representing a puzzle

1267: Revisiting Puzzle 64: Thioredoxin

Closed since over 9 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
August 03, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This human protein helps to regulate the reduction potential of the cell, and should be modeled here in reduced form (with no disulfide bonds). We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVNDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV

Top groups


  1. Avatar for Beta Folders 100 pts. 10,004
  2. Avatar for Contenders 2. Contenders 73 pts. 9,977
  3. Avatar for Go Science 3. Go Science 52 pts. 9,972
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 36 pts. 9,960
  5. Avatar for Void Crushers 5. Void Crushers 24 pts. 9,954
  6. Avatar for Gargleblasters 6. Gargleblasters 16 pts. 9,954
  7. Avatar for HMT heritage 7. HMT heritage 10 pts. 9,947
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 6 pts. 9,932
  9. Avatar for Deleted group 9. Deleted group pts. 9,929
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 2 pts. 9,892

  1. Avatar for taminnugget 141. taminnugget Lv 1 1 pt. 9,563
  2. Avatar for ahmedadelelbaz 142. ahmedadelelbaz Lv 1 1 pt. 9,560
  3. Avatar for ionikha 143. ionikha Lv 1 1 pt. 9,560
  4. Avatar for joshdearing 144. joshdearing Lv 1 1 pt. 9,553
  5. Avatar for vizerot 145. vizerot Lv 1 1 pt. 9,551
  6. Avatar for rinze 146. rinze Lv 1 1 pt. 9,549
  7. Avatar for Wheeler22 147. Wheeler22 Lv 1 1 pt. 9,547
  8. Avatar for pfirth 148. pfirth Lv 1 1 pt. 9,545
  9. Avatar for MSrdic 149. MSrdic Lv 1 1 pt. 9,543
  10. Avatar for Ref_Jo 150. Ref_Jo Lv 1 1 pt. 9,543

Comments