Placeholder image of a protein
Icon representing a puzzle

1267: Revisiting Puzzle 64: Thioredoxin

Closed since over 9 years ago

Intermediate Overall Prediction

Summary

Created
August 03, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This human protein helps to regulate the reduction potential of the cell, and should be modeled here in reduced form (with no disulfide bonds). We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVNDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 10,004
  2. Avatar for Contenders 2. Contenders 73 pts. 9,977
  3. Avatar for Go Science 3. Go Science 52 pts. 9,972
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 36 pts. 9,960
  5. Avatar for Void Crushers 5. Void Crushers 24 pts. 9,954
  6. Avatar for Gargleblasters 6. Gargleblasters 16 pts. 9,954
  7. Avatar for HMT heritage 7. HMT heritage 10 pts. 9,947
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 6 pts. 9,932
  9. Avatar for Deleted group 9. Deleted group pts. 9,929
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 2 pts. 9,892
  1. Avatar for drumpeter18yrs9yrs 131. drumpeter18yrs9yrs Lv 1 1 pt. 9,599
  2. Avatar for Deleted player 132. Deleted player 1 pt. 9,597
  3. Avatar for rossco0407 133. rossco0407 Lv 1 1 pt. 9,588
  4. Avatar for Ciccillo 134. Ciccillo Lv 1 1 pt. 9,587
  5. Avatar for lamoille 135. lamoille Lv 1 1 pt. 9,581
  6. Avatar for lynnai 136. lynnai Lv 1 1 pt. 9,577
  7. Avatar for Cerzax 137. Cerzax Lv 1 1 pt. 9,573
  8. Avatar for shacamin 138. shacamin Lv 1 1 pt. 9,568
  9. Avatar for DScott 139. DScott Lv 1 1 pt. 9,565
  10. Avatar for fishercat 140. fishercat Lv 1 1 pt. 9,563

Comments