1267: Revisiting Puzzle 64: Thioredoxin

Closed since over 9 years ago

Summary

• Created: August 03, 2016
• Expires: August 10, 2016 at 18:00 UTC
• Max points: 100

Description

This is a throwback puzzle to the early days of Foldit. This human protein helps to regulate the reduction potential of the cell, and should be modeled here in reduced form (with no disulfide bonds). We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVNDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV

Top groups

• 1. Beta Folders 100 pts. 10,004
• 2. Contenders 73 pts. 9,977
• 3. Go Science 52 pts. 9,972
• 4. Anthropic Dreams 36 pts. 9,960
• 5. Void Crushers 24 pts. 9,954
• 6. Gargleblasters 16 pts. 9,954
• 7. HMT heritage 10 pts. 9,947
• 8. L'Alliance Francophone 6 pts. 9,932
• 9. Deleted group pts. 9,929
• 10. Italiani Al Lavoro 2 pts. 9,892

Top soloists

• 31. pmdpmd 43 pts. 9,931
• 32. hpaege 42 pts. 9,930
• 33. Steven Pletsch 40 pts. 9,929
• 34. smilingone 39 pts. 9,927
• 35. tallguy-13088 38 pts. 9,925
• 36. pvc78 37 pts. 9,925
• 37. Blipperman 36 pts. 9,922
• 38. Museka 35 pts. 9,921
• 39. jobo0502 33 pts. 9,919
• 40. joremen 32 pts. 9,918