Placeholder image of a protein
Icon representing a puzzle

1270: Revisiting Puzzle 66: Cytochrome

Closed since over 9 years ago

Intermediate Overall Prediction

Summary

Created
August 10, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to transfer electrons between substrates in bacteria. The protein is modeled here in reducing conditions, and no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


VDAEAVVQQKCISCHGGDLTGASAPAIDKAGANYSEEEILDIILNGQGGMPGGIAKGAEAEAVAAWLAEKK

Top groups

  1. Avatar for xkcd 11. xkcd 1 pt. 8,909
  2. Avatar for freefolder 12. freefolder 1 pt. 8,837
  3. Avatar for DSN @ Home 13. DSN @ Home 1 pt. 8,631
  4. Avatar for Cannabis Crew 14. Cannabis Crew 1 pt. 8,469
  1. Avatar for reefyrob
    1. reefyrob Lv 1
    100 pts. 9,213
  2. Avatar for bertro 2. bertro Lv 1 98 pts. 9,197
  3. Avatar for KarenCH 3. KarenCH Lv 1 95 pts. 9,195
  4. Avatar for toshiue 4. toshiue Lv 1 92 pts. 9,183
  5. Avatar for pauldunn 5. pauldunn Lv 1 90 pts. 9,180
  6. Avatar for Bruno Kestemont 6. Bruno Kestemont Lv 1 87 pts. 9,179
  7. Avatar for johnmitch 7. johnmitch Lv 1 85 pts. 9,177
  8. Avatar for mirp 8. mirp Lv 1 82 pts. 9,175
  9. Avatar for LociOiling 9. LociOiling Lv 1 80 pts. 9,174
  10. Avatar for smilingone 10. smilingone Lv 1 77 pts. 9,173

Comments