1270: Revisiting Puzzle 66: Cytochrome

Closed since over 9 years ago

Summary

• Created: August 10, 2016
• Expires: August 17, 2016 at 18:00 UTC
• Max points: 100

Description

This is a throwback puzzle to the early days of Foldit. This protein helps to transfer electrons between substrates in bacteria. The protein is modeled here in reducing conditions, and no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

VDAEAVVQQKCISCHGGDLTGASAPAIDKAGANYSEEEILDIILNGQGGMPGGIAKGAEAEAVAAWLAEKK

Top groups

• 1. Beta Folders 100 pts. 9,213
• 2. Anthropic Dreams 68 pts. 9,197
• 3. Go Science 44 pts. 9,185
• 4. Gargleblasters 27 pts. 9,179
• 5. Contenders 16 pts. 9,167
• 6. L'Alliance Francophone 9 pts. 9,159
• 7. Void Crushers 5 pts. 9,158
• 8. HMT heritage 3 pts. 9,126
• 9. Italiani Al Lavoro 1 pt. 9,120
• 10. Deleted group pts. 9,102

Top soloists

• 1. reefyrob 100 pts. 9,213
• 2. bertro 98 pts. 9,197
• 3. KarenCH 95 pts. 9,195
• 4. toshiue 92 pts. 9,183
• 5. pauldunn 90 pts. 9,180
• 6. Bruno Kestemont 87 pts. 9,179
• 7. johnmitch 85 pts. 9,177
• 8. mirp 82 pts. 9,175
• 9. LociOiling 80 pts. 9,174
• 10. smilingone 77 pts. 9,173