Placeholder image of a protein
Icon representing a puzzle

1270: Revisiting Puzzle 66: Cytochrome

Closed since over 9 years ago

Intermediate Overall Prediction

Summary


Created
August 10, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to transfer electrons between substrates in bacteria. The protein is modeled here in reducing conditions, and no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


VDAEAVVQQKCISCHGGDLTGASAPAIDKAGANYSEEEILDIILNGQGGMPGGIAKGAEAEAVAAWLAEKK

Top groups


  1. Avatar for Beta Folders 100 pts. 9,213
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 68 pts. 9,197
  3. Avatar for Go Science 3. Go Science 44 pts. 9,185
  4. Avatar for Gargleblasters 4. Gargleblasters 27 pts. 9,179
  5. Avatar for Contenders 5. Contenders 16 pts. 9,167
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 9 pts. 9,159
  7. Avatar for Void Crushers 7. Void Crushers 5 pts. 9,158
  8. Avatar for HMT heritage 8. HMT heritage 3 pts. 9,126
  9. Avatar for Italiani Al Lavoro 9. Italiani Al Lavoro 1 pt. 9,120
  10. Avatar for Deleted group 10. Deleted group pts. 9,102

  1. Avatar for smilingone
    1. smilingone Lv 1
    100 pts. 9,199
  2. Avatar for LociOiling 2. LociOiling Lv 1 81 pts. 9,199
  3. Avatar for reefyrob 3. reefyrob Lv 1 65 pts. 9,197
  4. Avatar for Galaxie 4. Galaxie Lv 1 52 pts. 9,197
  5. Avatar for bertro 5. bertro Lv 1 41 pts. 9,193
  6. Avatar for lamoille 6. lamoille Lv 1 32 pts. 9,191
  7. Avatar for Deleted player 7. Deleted player 24 pts. 9,188
  8. Avatar for Bruno Kestemont 8. Bruno Kestemont Lv 1 18 pts. 9,185
  9. Avatar for mirp 9. mirp Lv 1 14 pts. 9,184
  10. Avatar for Hollinas 10. Hollinas Lv 1 10 pts. 9,182

Comments