Placeholder image of a protein
Icon representing a puzzle

1270: Revisiting Puzzle 66: Cytochrome

Closed since over 9 years ago

Intermediate Overall Prediction

Summary


Created
August 10, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to transfer electrons between substrates in bacteria. The protein is modeled here in reducing conditions, and no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


VDAEAVVQQKCISCHGGDLTGASAPAIDKAGANYSEEEILDIILNGQGGMPGGIAKGAEAEAVAAWLAEKK

Top groups


  1. Avatar for Beta Folders 100 pts. 9,213
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 68 pts. 9,197
  3. Avatar for Go Science 3. Go Science 44 pts. 9,185
  4. Avatar for Gargleblasters 4. Gargleblasters 27 pts. 9,179
  5. Avatar for Contenders 5. Contenders 16 pts. 9,167
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 9 pts. 9,159
  7. Avatar for Void Crushers 7. Void Crushers 5 pts. 9,158
  8. Avatar for HMT heritage 8. HMT heritage 3 pts. 9,126
  9. Avatar for Italiani Al Lavoro 9. Italiani Al Lavoro 1 pt. 9,120
  10. Avatar for Deleted group 10. Deleted group pts. 9,102

  1. Avatar for rezaefar 91. rezaefar Lv 1 3 pts. 8,970
  2. Avatar for jebbiek 92. jebbiek Lv 1 3 pts. 8,968
  3. Avatar for navn 93. navn Lv 1 3 pts. 8,965
  4. Avatar for pfirth 94. pfirth Lv 1 3 pts. 8,956
  5. Avatar for harvardman 95. harvardman Lv 1 3 pts. 8,951
  6. Avatar for Punktchen 96. Punktchen Lv 1 3 pts. 8,949
  7. Avatar for pizpot 97. pizpot Lv 1 2 pts. 8,933
  8. Avatar for altejoh 98. altejoh Lv 1 2 pts. 8,933
  9. Avatar for Thebatman012 99. Thebatman012 Lv 1 2 pts. 8,930
  10. Avatar for kvasirthewise 100. kvasirthewise Lv 1 2 pts. 8,921

Comments