Placeholder image of a protein
Icon representing a puzzle

1270: Revisiting Puzzle 66: Cytochrome

Closed since over 9 years ago

Intermediate Overall Prediction

Summary

Created
August 10, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to transfer electrons between substrates in bacteria. The protein is modeled here in reducing conditions, and no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


VDAEAVVQQKCISCHGGDLTGASAPAIDKAGANYSEEEILDIILNGQGGMPGGIAKGAEAEAVAAWLAEKK

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 9,213
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 68 pts. 9,197
  3. Avatar for Go Science 3. Go Science 44 pts. 9,185
  4. Avatar for Gargleblasters 4. Gargleblasters 27 pts. 9,179
  5. Avatar for Contenders 5. Contenders 16 pts. 9,167
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 9 pts. 9,159
  7. Avatar for Void Crushers 7. Void Crushers 5 pts. 9,158
  8. Avatar for HMT heritage 8. HMT heritage 3 pts. 9,126
  9. Avatar for Italiani Al Lavoro 9. Italiani Al Lavoro 1 pt. 9,120
  10. Avatar for Deleted group 10. Deleted group pts. 9,102
  1. Avatar for rossco0407 161. rossco0407 Lv 1 1 pt. 8,588
  2. Avatar for JimToast 162. JimToast Lv 1 1 pt. 8,588
  3. Avatar for emtonsti 163. emtonsti Lv 1 1 pt. 8,587
  4. Avatar for stepniew 164. stepniew Lv 1 1 pt. 8,584
  5. Avatar for nagistick 165. nagistick Lv 1 1 pt. 8,566
  6. Avatar for Ashrai 166. Ashrai Lv 1 1 pt. 8,552
  7. Avatar for NotJim99 167. NotJim99 Lv 1 1 pt. 8,520
  8. Avatar for Lord_c_nu 168. Lord_c_nu Lv 1 1 pt. 8,469
  9. Avatar for DangerHobo 169. DangerHobo Lv 1 1 pt. 8,406
  10. Avatar for Tac1 170. Tac1 Lv 1 1 pt. 8,393

Comments